Enter a sequence in the top search bar to search for matching PDB entities.
Sequence Searches at RCSB.org use MMseqs2 to find similar protein and nucleic acid sequences in the archive.
For example, a search for the sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKT will currently return >400 entities for exploration. Including the option for CSMs will add ~100 more examples.
References
- RCSB.org Sequence Documentation
- MMseqs2 enables sensitive protein sequence searching for the analysis of massive data sets (2017) Nat Biotechnol 35: 1026–1028 doi: 10.1038/nbt.3988
















